PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010091608.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family YABBY
Protein Properties Length: 190aa    MW: 21354.7 Da    PI: 8.3294
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010091608.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY141.31.1e-43141565160
           YABBY   5 ssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslkeelleelkveeenlksnvekeesastsvsse 99 
                      s++++Cyv+CnfC+t+lav++P++ l+ +vtv+CGhC++l    l+++  l++a++ ld+          ++ +e  k ++++++s+s+s    
  XP_010091608.1  14 PSTDHLCYVRCNFCSTVLAVALPYKRLLDTVTVKCGHCSNLSF--LSTRPPLQPAHQFLDHPNL----SLPGFCNEFRKGHYSSSSSSSSS---- 98 
                     589*************************************866..7777788888887665322....22233222222223333333333.... PP

           YABBY 100 klsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknW 160
                         +++  +p++p v +PPek+ r Psaynrf+keeiqrika+nP+i hreafsaaakn 
  XP_010091608.1  99 ---ISSEPISPKAPFVLKPPEKKHRLPSAYNRFMKEEIQRIKAANPEIPHREAFSAAAKNI 156
                     ...344556799999********************************************95 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046903.3E-5016156IPR006780YABBY protein
SuperFamilySSF470957.33E-7103153IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010254Biological Processnectary development
GO:0010582Biological Processfloral meristem determinacy
GO:0048479Biological Processstyle development
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
MNLEEKVAVD FVPPSTDHLC YVRCNFCSTV LAVALPYKRL LDTVTVKCGH CSNLSFLSTR  60
PPLQPAHQFL DHPNLSLPGF CNEFRKGHYS SSSSSSSSIS SEPISPKAPF VLKPPEKKHR  120
LPSAYNRFMK EEIQRIKAAN PEIPHREAFS AAAKNINIDP FRLSFCENEV GYYLVHVICP  180
KIPCMFISDI
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00220DAPTransfer from AT1G69180Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010091608.11e-138hypothetical protein L484_026456
SwissprotQ76EJ05e-57YABDL_ORYSJ; Protein DROOPING LEAF
TrEMBLW9QYX51e-138W9QYX5_9R
STRINGVIT_01s0011g00140.t012e-70(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF102593040
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69180.11e-53YABBY family protein